Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RPL37 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | RPL37 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1799220
![]() |
Novus Biologicals
NBP17991220UL |
20 μL |
Each for $206.00
|
|
|||||
NBP179912
![]() |
Novus Biologicals
NBP179912 |
100 μL |
Each for $487.50
|
|
|||||
Description
RPL37 Polyclonal specifically detects RPL37 in Human samples. It is validated for Western Blot.Specifications
RPL37 | |
Polyclonal | |
Rabbit | |
NP_000988 | |
6167 | |
The immunogen for this antibody is RPL37. Peptide sequence PAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp686G1699, G1.16, MGC99572,60S ribosomal protein L37,60S ribosomal protein L37a, ribosomal protein L37 | |
RPL37 | |
IgG | |
11 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title