RPRD1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP321336100UL

Catalog No. NB236755

Description

RPRD1B Polyclonal antibody specifically detects RPRD1B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: RPRD1B
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Cell cycle-related and expression-elevated protein in tumor, cell-cycle related and expression-elevated protein in tumor, chromosome 20 open reading frame 77, CREPTC20orf77, dJ1057B20.2, DKFZp434P0735, FLJ44520, NET60, regulation of nuclear pre-mRNA domain containing 1B, regulation of nuclear pre-mRNA domain-containing protein 1B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RLAAELEDRRQLARMLVEYTQNQKDVLSEKEKK
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 58490
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG