Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RPRD1B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$330.00 - $547.00
Specifications
| Antigen | RPRD1B |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
RPRD1B Polyclonal antibody specifically detects RPRD1B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| RPRD1B | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Cell cycle-related and expression-elevated protein in tumor, cell-cycle related and expression-elevated protein in tumor, chromosome 20 open reading frame 77, CREPTC20orf77, dJ1057B20.2, DKFZp434P0735, FLJ44520, NET60, regulation of nuclear pre-mRNA domain containing 1B, regulation of nuclear pre-mRNA domain-containing protein 1B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RLAAELEDRRQLARMLVEYTQNQKDVLSEKEKK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 58490 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title