Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RPS7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15739420UL
Description
RPS7 Polyclonal specifically detects RPS7 in Human samples. It is validated for Western Blot.Specifications
RPS7 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P62081 | |
RPS7 | |
Synthetic peptides corresponding to RPS7(ribosomal protein S7) The peptide sequence was selected from the N terminal of RPS7. Peptide sequence MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DBA8,40S ribosomal protein S7, ribosomal protein S7 | |
Rabbit | |
Affinity Purified | |
RUO | |
6201 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction