RRAGD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156669

Catalog No. NBP156669

Description

RRAGD Polyclonal specifically detects RRAGD in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RRAGD
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: bA11D8.2.1, DKFZP761H171, FLJ44176, Rag D, Rag D protein, RAGD, Ras-related GTP binding D, ras-related GTP-binding protein D
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, mTOR Pathway
• Gene ID (Entrez): 58528
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NQL2
• Gene Symbols: RRAGD
• Immunogen: Synthetic peptides corresponding to RRAGD (Ras-related GTP binding D) The peptide sequence was selected from the middle region of RRAGD)(50ug). Peptide sequence CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Sheep: 77%; Zebrafish: 77%; Guinea pig: 77%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG