Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RRAGD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RRAGD |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RRAGD Polyclonal specifically detects RRAGD in Human samples. It is validated for Western Blot.Specifications
RRAGD | |
Polyclonal | |
Rabbit | |
Cancer, mTOR Pathway | |
bA11D8.2.1, DKFZP761H171, FLJ44176, Rag D, Rag D protein, RAGD, Ras-related GTP binding D, ras-related GTP-binding protein D | |
RRAGD | |
IgG | |
45 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9NQL2 | |
58528 | |
Synthetic peptides corresponding to RRAGD (Ras-related GTP binding D) The peptide sequence was selected from the middle region of RRAGD)(50ug). Peptide sequence CDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title