RRP4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258481

Catalog No. NBP258481

Description

RRP4 Polyclonal specifically detects RRP4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RRP4
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: exosome component 2Ribosomal RNA-processing protein 4, homolog of yeast RRP4 (ribosomal RNA processing 4), 3' 5' exoribonuclease(RRP4), homolog of yeast RRP4 (ribosomal RNA processing 4), 3'-5'-exoribonuclease, hRrp4p, p7, RRP4exosome complex exonuclease RRP4, Rrp4p
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23404
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: EXOSC2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTH
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only