RRP9 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157217

Catalog No. NBP157217

Description

RRP9 Polyclonal specifically detects RRP9 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RRP9
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O43818
• Gene Symbols: RRP9
• Immunogen: Synthetic peptides corresponding to RRP9 (RRP9, small subunit (SSU) processome component, homolog (yeast)) The peptide sequence was selected from the middle region of RRP9. Peptide sequence IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSCQH The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 92%; Rabbit: 92%; Bovine: 78%; Canine: 78%; Guinea pig: 78%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ribosomal RNA processing 9, small subunit (SSU) processome component, homolog(yeast), RNA, U3 small nucleolar interacting protein 2, RNU3IP2, RRP9 homolog, U3 small nucleolar ribonucleoprotein-associated 55 kDa protein, U3 small nucleolar RNA-interacting protein 2, U3 snoRNP-associated 55 kDa protein, U3 snoRNP-associated 55-kDa protein, U355K, U3-55KRRP9, small subunit (SSU) processome component, homolog
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9136
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG