Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RSF1 Antibody, Novus Biologicals™

RSF1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15299920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15299920 20 μL
NBP152999 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15299920 Supplier Novus Biologicals Supplier No. NBP15299920UL

Description

Rabbit Polyclonal Antibody

RSF1 Polyclonal specifically detects RSF1 in Human samples. It is validated for Western Blot.

Specifications

Antigen RSF1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias HBV pX associated protein-8, HBXAPp325 subunit of RSF chromatin-remodeling complex, hepatitis B virus x associated protein, Hepatitis B virus X-associated protein, p325, remodeling and spacing factor 1, Rsf-1, XAP8HBV pX-associated protein 8
Gene Symbols RSF1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RSF1(remodeling and spacing factor 1) The peptide sequence was selected from the middle region of RSF1. Peptide sequence QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK.
Molecular Weight of Antigen 164 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51773
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.