RSG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25897325UL

Catalog No. NB393191

Description

RSG1 Polyclonal specifically detects RSG1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RSG1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: C1orf89, chromosome 1 open reading frame 89, MGC10731, miro domain-containing protein C1orf89, Rem/Rab-Similar GTPase 1, REM2 and RAB-like small GTPase 1, RP4-733M16.4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RSG1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VHHETTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDHMLLACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGS
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 79363
• Target Species: Human
• Form: Purified

For Research Use Only