Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RSRC2 Antibody, Novus Biologicals™

RSRC2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15433220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15433220 20 μL
NBP154332 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15433220 Supplier Novus Biologicals Supplier No. NBP15433220UL

Description

Rabbit Polyclonal Antibody

RSRC2 Polyclonal specifically detects RSRC2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen RSRC2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q7L4I2
Gene Alias arginine/serine-rich coiled-coil 2, arginine/serine-rich coiled-coil protein 2, FLJ11021
Gene Symbols RSRC2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RSRC2(arginine/serine-rich coiled-coil 2) The peptide sequence was selected from the C terminal of RSRC2. Peptide sequence DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARS.
Molecular Weight of Antigen 50 kDa
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 65117
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.