RSU1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154879

Catalog No. NBP154879

Description

RSU1 Polyclonal specifically detects RSU1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RSU1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ31034, Ras suppressor protein 1, ras suppressor protein 1 variant 1, ras suppressor protein 1 variant 2, RSP1, RSP-1ras suppressor protein 1 variant 3, Rsu-1
• Host Species: Rabbit
• Molecular Weight of Antigen: 31 kDa
• Quantity: 100 μL
• Research Discipline: Vision
• Gene ID (Entrez): 6251
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q15404
• Gene Symbols: RSU1
• Immunogen: Synthetic peptides corresponding to RSU1(Ras suppressor protein 1) The peptide sequence was selected from the C terminal of RSU1. Peptide sequence PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only