RTCD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25871425UL

Catalog No. NB393314

Description

RTCD1 Polyclonal specifically detects RTCD1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RTCD1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: phosphate cyclase, RNA 3'-terminal phosphate cyclase, RNA cyclase, RNA terminal phosphate cyclase domain 1, RNA terminal phosphate cyclase domain-containing protein 1, RNA-3'-phosphate cyclase, RPC1, RPCEC 6.5.1.4, RTC domain containing 1, RTC domain-containing protein 1, RTC1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RTCA
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLANLRHGGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKDTYIIECQGIGMTNPNL
• Quantity: 25 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 8634
• Target Species: Human
• Isotype: IgG

For Research Use Only