Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RTCD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | RTCD1 |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RTCD1 Polyclonal specifically detects RTCD1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
RTCD1 | |
Polyclonal | |
Rabbit | |
DNA replication Transcription Translation and Splicing | |
phosphate cyclase, RNA 3'-terminal phosphate cyclase, RNA cyclase, RNA terminal phosphate cyclase domain 1, RNA terminal phosphate cyclase domain-containing protein 1, RNA-3'-phosphate cyclase, RPC1, RPCEC 6.5.1.4, RTC domain containing 1, RTC domain-containing protein 1, RTC1 | |
RTCA | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
8634 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLANLRHGGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKDTYIIECQGIGMTNPNL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title