RTP4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156448

Catalog No. NBP156448

Description

RTP4 Polyclonal specifically detects RTP4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RTP4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: IFRG28receptor transporting protein 4, receptor (chemosensory) transporter protein 4,28kD interferon responsive protein, receptor transporter protein 4, receptor-transporting protein 4,28 kDa interferon-responsive protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96DX8
• Gene Symbols: RTP4
• Immunogen: Synthetic peptides corresponding to RTP4 (receptor (chemosensory) transporter protein 4) The peptide sequence was selected from the middle region of RTP4)(50ug). Peptide sequence SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA.
• Quantity: 100 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 64108
• Target Species: Human
• Isotype: IgG