Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RTP4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15644820UL
Description
RTP4 Polyclonal specifically detects RTP4 in Human samples. It is validated for Western Blot.Specifications
RTP4 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q96DX8 | |
RTP4 | |
Synthetic peptides corresponding to RTP4 (receptor (chemosensory) transporter protein 4) The peptide sequence was selected from the middle region of RTP4)(50ug). Peptide sequence SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
IFRG28receptor transporting protein 4, receptor (chemosensory) transporter protein 4,28kD interferon responsive protein, receptor transporter protein 4, receptor-transporting protein 4,28 kDa interferon-responsive protein | |
Rabbit | |
Affinity Purified | |
RUO | |
64108 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction