Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RUVBL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP184914
Description
RUVBL1 Polyclonal specifically detects RUVBL1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
RUVBL1 | |
Polyclonal | |
Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated | |
49 kDa TATA box-binding protein-interacting protein, 54 kDa erythrocyte cytosolic protein, EC 3.6.1, EC 3.6.4.12,49 kDa TBP-interacting protein, ECP54, INO80 complex subunit H, INO80HTIP49A, NMP 238, NMP238ECP-54, Nuclear matrix protein 238, PONTIN, Pontin 52, Pontin52, RuvB (E coli homolog)-like 1, ruvB-like 1, RuvB-like 1 (E. coli), RVB1, TATA binding protein interacting protein 49 kDa, TIH1, TIP49a, TIP49TAP54-alpha, TIP60-associated protein 54-alpha | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
RUVBL1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDV | |
0.1 mL | |
Core ESC Like Genes, Stem Cell Markers, Wnt Signaling Pathway | |
8607 | |
Human | |
IgG |
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction