RUVBL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB406815	Novus Biologicals NBP18491425UL	25ul
NBP184914	Novus Biologicals NBP184914	0.1 mL

Description

RUVBL1 Polyclonal specifically detects RUVBL1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: RUVBL1
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Core ESC Like Genes, Stem Cell Markers, Wnt Signaling Pathway
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 8607
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDV
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: 49 kDa TATA box-binding protein-interacting protein, 54 kDa erythrocyte cytosolic protein, EC 3.6.1, EC 3.6.4.12,49 kDa TBP-interacting protein, ECP54, INO80 complex subunit H, INO80HTIP49A, NMP 238, NMP238ECP-54, Nuclear matrix protein 238, PONTIN, Pontin 52, Pontin52, RuvB (E coli homolog)-like 1, ruvB-like 1, RuvB-like 1 (E. coli), RVB1, TATA binding protein interacting protein 49 kDa, TIH1, TIP49a, TIP49TAP54-alpha, TIP60-associated protein 54-alpha
• Gene Symbols: RUVBL1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only