Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RXR gamma/NR2B3 Antibody, Novus Biologicals™

RXR gamma/NR2B3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15281520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15281520 20 μL
NBP152815 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15281520 Supplier Novus Biologicals Supplier No. NBP15281520UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

RXR gamma/NR2B3 Polyclonal specifically detects RXR gamma/NR2B3 in Human samples. It is validated for Western Blot.

Specifications

Antigen RXR gamma/NR2B3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P48443
Gene Alias NR2B3retinoid X receptor-gamma, Nuclear receptor subfamily 2 group B member 3, retinoic acid receptor RXR-gamma, Retinoid X receptor gamma, retinoid X receptor, gamma, RXRC
Gene Symbols RXRG
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RXRG(retinoid X receptor, gamma) The peptide sequence was selected from the N terminal of RXRG. Peptide sequence NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cancer, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 6258
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.