Ryanodine Receptor 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23378525UL

Catalog No. NB436754

Description

Ryanodine Receptor 1 Polyclonal specifically detects Ryanodine Receptor 1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Ryanodine Receptor 1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: P21817
• Gene Symbols: RYR1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: REFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYYLDQTEHPYKSKK
• Quantity: 25 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 6261
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CCO, central core disease of muscle, MHS, MHS1, PPP1R137, protein phosphatase 1, regulatory subunit 137, ryanodine receptor 1, ryanodine receptor 1 (skeletal), ryanodine receptor type1, RYDR, RYR, RyR1, RYR-1, sarcoplasmic reticulum calcium release channel, Skeletal muscle calcium release channel, skeletal muscle ryanodine receptor, Skeletal muscle-type ryanodine receptor, SKRR, type 1-like ryanodine receptor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only