Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Ryanodine Receptor 1 Antibody, Novus Biologicals™

Ryanodine Receptor 1 Antibody, Novus Biologicals™
SDP

Catalog No. NB436754 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB436754 25 μL
NBP233785 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB436754 Supplier Novus Biologicals Supplier No. NBP23378525UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Ryanodine Receptor 1 Polyclonal specifically detects Ryanodine Receptor 1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen Ryanodine Receptor 1
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P21817
Gene Alias CCO, central core disease of muscle, MHS, MHS1, PPP1R137, protein phosphatase 1, regulatory subunit 137, ryanodine receptor 1, ryanodine receptor 1 (skeletal), ryanodine receptor type1, RYDR, RYR, RyR1, RYR-1, sarcoplasmic reticulum calcium release channel, Skeletal muscle calcium release channel, skeletal muscle ryanodine receptor, Skeletal muscle-type ryanodine receptor, SKRR, type 1-like ryanodine receptor
Gene Symbols RYR1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: REFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYYLDQTEHPYKSKK
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 6261
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.