Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ryanodine Receptor 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Ryanodine Receptor 1 |
---|---|
Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Ryanodine Receptor 1 Polyclonal specifically detects Ryanodine Receptor 1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Ryanodine Receptor 1 | |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
P21817 | |
6261 | |
This antibody was developed against a recombinant protein corresponding to amino acids: REFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYYLDQTEHPYKSKK | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Rabbit | |
Neuroscience | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CCO, central core disease of muscle, MHS, MHS1, PPP1R137, protein phosphatase 1, regulatory subunit 137, ryanodine receptor 1, ryanodine receptor 1 (skeletal), ryanodine receptor type1, RYDR, RYR, RyR1, RYR-1, sarcoplasmic reticulum calcium release channel, Skeletal muscle calcium release channel, skeletal muscle ryanodine receptor, Skeletal muscle-type ryanodine receptor, SKRR, type 1-like ryanodine receptor | |
RYR1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title