Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

S100A4 Antibody (CL0237), Novus Biologicals™
SDP

Catalog No. NB395371 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395371 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB395371 Supplier Novus Biologicals Supplier No. NBP25289025UL
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

S100A4 Monoclonal antibody specifically detects S100A4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen S100A4
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL0237
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/ Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias 18A2, Calvasculin, CAPLS100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, fibroblast-specific protein-1,42A, FSP1, leukemia multidrug resistance associated protein, malignant transformation suppression 1, Metastasin, MTS1, murine placental homolog), P9KA, PEL98, Placental calcium-binding protein, Protein Mts1, protein S100-A4, S100 calcium binding protein A4, S100 calcium-binding protein A4, S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 6275
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.