Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. S1P2/EDG-5/S1PR2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

S1P2/EDG-5/S1PR2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB125037 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB125037 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB125037 Supplier Novus Biologicals Supplier No. NBP310068100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

S1P2/EDG-5/S1PR2 Polyclonal specifically detects S1P2/EDG-5/S1PR2 in Human samples. It is validated for Western Blot.

Specifications

Antigen S1P2/EDG-5/S1PR2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias AGR16, EDG5, EDG-5, endothelial differentiation G-protein coupled receptor 5, endothelial differentiation, sphingolipid G-protein-coupled receptor, 5, Gpcr13, H218, LPB2, S1P receptor 2, S1P receptor Edg-5, S1P receptor EDG5, S1P2, sphingosine 1-phosphate receptor 2, sphingosine 1-phosphate receptor Edg-5, sphingosine-1-phosphate receptor 2
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human S1P2/EDG-5/S1PR2 (NP_004221.3). Peptide sequence VHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVLRPLQCWRPGV
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline GPCR
Primary or Secondary Primary
Gene ID (Entrez) 9294
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.