Salivary Amylase Alpha Rabbit anti-Mouse, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309325100UL

Catalog No. NB123551

Description

Salivary Amylase Alpha Polyclonal specifically detects Salivary Amylase Alpha in Mouse, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: Salivary Amylase Alpha
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: 1,4-alpha-D-glucan glucanohydrolase 1, alpha-amylase 1, AMY1, AMY1B, AMY1C, amylase, alpha 1A (salivary), amylase, alpha 1A; salivary, amylase, salivary, alpha-1A, EC 3.2.1.1, glycogenase, Salivary alpha-amylase, salivary amylase alpha 1A
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Salivary Amylase Alpha (NP_001010970). Peptide sequence YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 276
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.