Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Salivary Amylase Alpha Rabbit anti-Mouse, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Salivary Amylase Alpha |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Salivary Amylase Alpha Polyclonal specifically detects Salivary Amylase Alpha in Mouse, Rat samples. It is validated for Western Blot.Specifications
Salivary Amylase Alpha | |
Western Blot | |
Unconjugated | |
Rabbit | |
Mouse, Rat | |
1,4-alpha-D-glucan glucanohydrolase 1, alpha-amylase 1, AMY1, AMY1B, AMY1C, amylase, alpha 1A (salivary), amylase, alpha 1A; salivary, amylase, salivary, alpha-1A, EC 3.2.1.1, glycogenase, Salivary alpha-amylase, salivary amylase alpha 1A | |
The immunogen is a synthetic peptide directed towards the middle region of Rat Salivary Amylase Alpha (NP_001010970). Peptide sequence YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
276 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title