Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Salivary Amylase Alpha Rabbit anti-Mouse, Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$106.19 - $320.71
Specifications
| Antigen | Salivary Amylase Alpha |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Conjugate | Unconjugated |
| Format | Purified |
Description
Salivary Amylase Alpha Polyclonal specifically detects Salivary Amylase Alpha in Mouse, Rat samples. It is validated for Western Blot.Specifications
| Salivary Amylase Alpha | |
| Western Blot | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 276 | |
| Polyclonal | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Unconjugated | |
| Rabbit | |
| Mouse, Rat | |
| 1,4-alpha-D-glucan glucanohydrolase 1, alpha-amylase 1, AMY1, AMY1B, AMY1C, amylase, alpha 1A (salivary), amylase, alpha 1A; salivary, amylase, salivary, alpha-1A, EC 3.2.1.1, glycogenase, Salivary alpha-amylase, salivary amylase alpha 1A | |
| The immunogen is a synthetic peptide directed towards the middle region of Rat Salivary Amylase Alpha (NP_001010970). Peptide sequence YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title