SAMD4B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25580025UL

Catalog No. NB394814

Description

SAMD4B Polyclonal specifically detects SAMD4B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SAMD4B
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: FLJ10211, hSmaug2, MGC99832, protein Smaug homolog 2, SAM domain-containing protein 4B, smaug 2, smaug homolog B, SMAUG2, SMGB, sterile alpha motif domain containing 4B, sterile alpha motif domain-containing protein 4B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55095
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SAMD4B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IIITPIKAYSVLQATVAAATTTPTAKDGAPGEPPLPGAEPPLAHPGTDKGTEAKDPPAVENYPPPP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only