Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SAMD8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16011320UL
Description
SAMD8 Polyclonal specifically detects SAMD8 in Human samples. It is validated for Western Blot.Specifications
SAMD8 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q5JSC8 | |
SAMD8 | |
Synthetic peptides corresponding to SAMD8(sterile alpha motif domain containing 8) The peptide sequence was selected from the middle region of SAMD8 (NP_653261). Peptide sequence MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL. | |
20 μL | |
Lipid and Metabolism | |
142891 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ25082, SAM domain-containing protein 8, SMSr, sphingomyelin synthase related, sphingomyelin synthase-related protein 1, sterile alpha motif domain containing 8, Sterile alpha motif domain-containing protein 8 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction