Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SAMD8 Antibody, Novus Biologicals™

SAMD8 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1601320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1601320 20 μL
NBP160113 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1601320 Supplier Novus Biologicals Supplier No. NBP16011320UL

Description

Rabbit Polyclonal Antibody

SAMD8 Polyclonal specifically detects SAMD8 in Human samples. It is validated for Western Blot.

Specifications

Antigen SAMD8
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q5JSC8
Gene Alias FLJ25082, SAM domain-containing protein 8, SMSr, sphingomyelin synthase related, sphingomyelin synthase-related protein 1, sterile alpha motif domain containing 8, Sterile alpha motif domain-containing protein 8
Gene Symbols SAMD8
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SAMD8(sterile alpha motif domain containing 8) The peptide sequence was selected from the middle region of SAMD8 (NP_653261). Peptide sequence MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 142891
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.