Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SAMD8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	SAMD8
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP1601320 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP16011320UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP160113 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP160113	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SAMD8 Polyclonal specifically detects SAMD8 in Human samples. It is validated for Western Blot.

Specifications

Antigen	SAMD8
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Lipid and Metabolism
Gene Alias	FLJ25082, SAM domain-containing protein 8, SMSr, sphingomyelin synthase related, sphingomyelin synthase-related protein 1, sterile alpha motif domain containing 8, Sterile alpha motif domain-containing protein 8
Gene Symbols	SAMD8
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q5JSC8
Gene ID (Entrez)	142891
Immunogen	Synthetic peptides corresponding to SAMD8(sterile alpha motif domain containing 8) The peptide sequence was selected from the middle region of SAMD8 (NP_653261). Peptide sequence MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SAMD8 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents