Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SAR1B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen SAR1B
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124916
View Documents
Novus Biologicals
NBP31000725UL
25 μg
Each for $106.19
Add to cart
 
NB124915
View Documents
Novus Biologicals
NBP310007100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

SAR1B Polyclonal antibody specifically detects SAR1B in Human samples. It is validated for Western Blot
Specifications

Specifications

SAR1B
Western Blot
Purified
RUO
Human
2310075M17Rik, ANDD, CMRD, EC 3.6.5, GTP-binding protein B, GTP-binding protein SAR1b, GTP-binding protein Sara, SAR1 homolog B (S. cerevisiae), SAR1a gene homolog (S. cerevisiae) 2, SAR1a gene homolog 2, SAR1a gene homolog 2 (S. cerevisiae), SARA2GTBPB, SARB
The immunogen is a synthetic peptide directed towards the middle region of human SAR1B (NP_001028675.1). Peptide sequence RPEAISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSVLKRQGYG
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Signal Transduction
PBS buffer, 2% sucrose
51128
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit