Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SARS-CoV-2 nsp6 Rabbit anti-SARS-CoV-2, Polyclonal, Novus Biologicals™

SARS-CoV-2 nsp6 Rabbit anti-SARS-CoV-2, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB167095 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB167095 100 μg
NB167096 20 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB167095 Supplier Novus Biologicals Supplier No. NBP316000100UL
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SARS-CoV-2 nsp6 Polyclonal antibody specifically detects SARS-CoV-2 nsp6 in SARS-CoV-2 samples. It is validated for Western Blot

Specifications

Antigen SARS-CoV-2 nsp6
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS, 50% glycerol, pH7.3
Gene Alias Non-structural protein 6
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 236-290 of coronavirus NSP6 (YP_009725302.1). RLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQ
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Infections (Virus Bacteria and Parasites)
Primary or Secondary Primary
Gene ID (Entrez) 43740578
Target Species SARS-CoV-2
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.