Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SARS Nucleocapsid Protein Antibody (AP201054), mFluor Violet 500 SE, Novus Biologicals™
SDP

Catalog No. NB360363 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB360363 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB360363 Supplier Novus Biologicals Supplier No. NBP290967MFV500
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

SARS Nucleocapsid Protein Monoclonal antibody specifically detects SARS Nucleocapsid Protein in SARS-CoV, SARS-CoV-2 samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoassay, Direct ELISA

Specifications

Antigen SARS Nucleocapsid Protein
Applications Western Blot, ELISA, Immunocytochemistry, Immunoassay, Direct ELISA
Classification Monoclonal
Clone AP201054
Conjugate mFluor Violet 500 SE
Dilution Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoassay, Direct ELISA
Formulation 50mM Sodium Borate
Gene Alias N, N protein, N structural protein, NC, Nucleocapsid protein, Nucleoprotein, Protein N, SARS coronavirus N protein, SARS coronavirus nucleocapsid protein, SARS CoV, SARS CoV N protein, SARS CoV nucleocapsid protein, SARS N protein, SARS Nucleoprotein, SARSCoV, SARSCoV N protein, SARSCoV nucleocapsid protein, Severe acute respiratory syndrome
Host Species Mouse
Immunogen The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1)
Purification Method Protein G purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Infections (Virus Bacteria and Parasites)
Primary or Secondary Primary
Gene ID (Entrez) 1489678
Target Species SARS-CoV, SARS-CoV-2
Content And Storage Store at 4C in the dark.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.