SART1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP189024

Catalog No. NBP189024

Description

SART1 Polyclonal specifically detects SART1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SART1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: Allergen Hom s 1, Ara1, HAF, HOMS1, hSART-1, hSnu66, hypoxia-associated factor, IgE autoantigen, MGC2038, SART-1, SART1(259) protein, SART1(800) protein, SART1259, small nuclear ribonucleoprotein 110kDa (U4/U6.U5), SNRNP110, Snu66, SNU66 homolog, squamous cell carcinoma antigen recognised by T cells, squamous cell carcinoma antigen recognized by T cells, Squamous cell carcinoma antigen recognized by T cells 1, U4/U6.U5 tri-snRNP-associated 110 kDa protein, U4/U6.U5 tri-snRNP-associated protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9092
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SART1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGER
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only