Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SART1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP189024
Description
SART1 Polyclonal specifically detects SART1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
SART1 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Allergen Hom s 1, Ara1, HAF, HOMS1, hSART-1, hSnu66, hypoxia-associated factor, IgE autoantigen, MGC2038, SART-1, SART1(259) protein, SART1(800) protein, SART1259, small nuclear ribonucleoprotein 110kDa (U4/U6.U5), SNRNP110, Snu66, SNU66 homolog, squamous cell carcinoma antigen recognised by T cells, squamous cell carcinoma antigen recognized by T cells, Squamous cell carcinoma antigen recognized by T cells 1, U4/U6.U5 tri-snRNP-associated 110 kDa protein, U4/U6.U5 tri-snRNP-associated protein 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
9092 | |
Human, Mouse, Rat | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
SART1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:TMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGER | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction