SART1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB430964	Novus Biologicals NBP18902425UL	25 μL
NBP189024	Novus Biologicals NBP189024	0.1 mL

Description

SART1 Polyclonal specifically detects SART1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SART1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 9092
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGER
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Mouse, Rat
• Gene Alias: Allergen Hom s 1, Ara1, HAF, HOMS1, hSART-1, hSnu66, hypoxia-associated factor, IgE autoantigen, MGC2038, SART-1, SART1(259) protein, SART1(800) protein, SART1259, small nuclear ribonucleoprotein 110kDa (U4/U6.U5), SNRNP110, Snu66, SNU66 homolog, squamous cell carcinoma antigen recognised by T cells, squamous cell carcinoma antigen recognized by T cells, Squamous cell carcinoma antigen recognized by T cells 1, U4/U6.U5 tri-snRNP-associated 110 kDa protein, U4/U6.U5 tri-snRNP-associated protein 1
• Gene Symbols: SART1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only