Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SASH3 Antibody, Novus Biologicals™

SASH3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15688720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15688720 20 μL
NBP156887 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15688720 Supplier Novus Biologicals Supplier No. NBP15688720UL

Description

Rabbit Polyclonal Antibody

SASH3 Polyclonal specifically detects SASH3 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen SASH3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8K352
Gene Alias CXorf9, HACS2, SAM and SH3 domain containing 3, SAM and SH3 domain-containing protein 3, SH3 protein expressed in lymphocytes homolog, SH3D6C, SLYchromosome X open reading frame 9,753P9
Gene Symbols SASH3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CXORF9 The peptide sequence was selected from the N terminal of CXORF9. Peptide sequence KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54440
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.