Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SASH3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | SASH3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15688720
![]() |
Novus Biologicals
NBP15688720UL |
20 μL |
Each for $206.00
|
|
|||||
NBP156887
![]() |
Novus Biologicals
NBP156887 |
100 μL |
Each for $487.50
|
|
|||||
Description
SASH3 Polyclonal specifically detects SASH3 in Human samples. It is validated for Western Blot.Specifications
SASH3 | |
Polyclonal | |
Rabbit | |
Q8K352 | |
54440 | |
Synthetic peptides corresponding to CXORF9 The peptide sequence was selected from the N terminal of CXORF9. Peptide sequence KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CXorf9, HACS2, SAM and SH3 domain containing 3, SAM and SH3 domain-containing protein 3, SH3 protein expressed in lymphocytes homolog, SH3D6C, SLYchromosome X open reading frame 9,753P9 | |
SASH3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title