SC5DL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24947825UL

Catalog No. NB395667

Description

SC5DL Polyclonal antibody specifically detects SC5DL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SC5DL
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: 3beta-hydroxysteroid-delta5-desaturase, C-5 sterol desaturase, Delta(7)-sterol 5-desaturase, EC 1.14.21.6, ERG3, fungal ERG3, delta-5-desaturase-like, Lathosterol 5-desaturase, lathosterol dehydrogenase, lathosterol oxidase, S5DES, SC5D, Sterol-C5-desaturase, sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, fungal)-like, sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like, sterol-C5-desaturase (fungal ERG3, delta-5-desaturase)-like
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DLVLRVADYYFFTPYVYPATWPEDDIFRQAI
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6309
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG