Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SC5DL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | SC5DL |
---|---|
Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
SC5DL Polyclonal antibody specifically detects SC5DL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
SC5DL | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Human | |
3beta-hydroxysteroid-delta5-desaturase, C-5 sterol desaturase, Delta(7)-sterol 5-desaturase, EC 1.14.21.6, ERG3, fungal ERG3, delta-5-desaturase-like, Lathosterol 5-desaturase, lathosterol dehydrogenase, lathosterol oxidase, S5DES, SC5D, Sterol-C5-desaturase, sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, fungal)-like, sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like, sterol-C5-desaturase (fungal ERG3, delta-5-desaturase)-like | |
This antibody was developed against a recombinant protein corresponding to amino acids: DLVLRVADYYFFTPYVYPATWPEDDIFRQAI | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Purified | |
RUO | |
PBS (pH 7.2), 40% Glycerol | |
6309 | |
IgG | |
Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title