Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCAF11/SFRS2IP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25530625UL
Description
SCAF11/SFRS2IP Polyclonal specifically detects SCAF11/SFRS2IP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
SCAF11/SFRS2IP | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
CASP11Splicing regulatory protein 129, Renal carcinoma antigen NY-REN-40, serine/arginine-rich splicing factor 2, interacting protein, Serine/arginine-rich splicing factor 2-interacting protein, SFRS2-interacting protein, SFRS2IPSC35-interacting protein 1, SIP1SRSF2IP, splicing factor, arginine/serine-rich 2, interacting protein, Splicing factor, arginine/serine-rich 2-interacting protein, SR-related and CTD-associated factor 11, SR-related CTD-associated factor 11, SRrp129, SRRP129CTD-associated SR protein 11, SRSF2-interacting protein | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
SCAF11 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SFKFVEQQSYKRKSEQEFSFDTPADRSGWTSASSWAVRKTLPADVQNYYSRRGRNSSGPQSGWMKQEEETSGQDSSLKDQTNQ | |
25 μL | |
Apoptosis, Cancer, Caspases | |
9169 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction