Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCAF11/SFRS2IP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | SCAF11/SFRS2IP |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SCAF11/SFRS2IP Polyclonal specifically detects SCAF11/SFRS2IP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
SCAF11/SFRS2IP | |
Polyclonal | |
Rabbit | |
Apoptosis, Cancer, Caspases | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
9169 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SFKFVEQQSYKRKSEQEFSFDTPADRSGWTSASSWAVRKTLPADVQNYYSRRGRNSSGPQSGWMKQEEETSGQDSSLKDQTNQ | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
CASP11Splicing regulatory protein 129, Renal carcinoma antigen NY-REN-40, serine/arginine-rich splicing factor 2, interacting protein, Serine/arginine-rich splicing factor 2-interacting protein, SFRS2-interacting protein, SFRS2IPSC35-interacting protein 1, SIP1SRSF2IP, splicing factor, arginine/serine-rich 2, interacting protein, Splicing factor, arginine/serine-rich 2-interacting protein, SR-related and CTD-associated factor 11, SR-related CTD-associated factor 11, SRrp129, SRRP129CTD-associated SR protein 11, SRSF2-interacting protein | |
SCAF11 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title