Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCAF8/RBM16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23401525UL
Description
SCAF8/RBM16 Polyclonal specifically detects SCAF8/RBM16 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
SCAF8/RBM16 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Q9UPN6 | |
SCAF8 | |
This antibody was developed against a recombinant protein corresponding to amino acids: LSMTPETVKDVGFGSLVIPGGSVASNLATSALPAGNVFNAPTKQAEPEEKVPHLIDHQISSGENTRSVIPNDISSNAAILG | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CCAP7, CDC5L complex-associated protein 7, KIAA1116RNA-binding protein 16, putative RNA-binding protein 16, RBM16, RNA binding motif protein 16, RNA-binding motif protein 16, SR-like CTD-associated factor 8, SR-related and CTD-associated factor 8, SR-related CTD-associated factor 8 | |
Rabbit | |
Affinity Purified | |
RUO | |
22828 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction