SCAF8/RBM16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB436674	Novus Biologicals NBP23401525UL	25 μL
NBP234015	Novus Biologicals NBP234015	0.1 mL

Description

SCAF8/RBM16 Polyclonal specifically detects SCAF8/RBM16 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SCAF8/RBM16
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CCAP7, CDC5L complex-associated protein 7, KIAA1116RNA-binding protein 16, putative RNA-binding protein 16, RBM16, RNA binding motif protein 16, RNA-binding motif protein 16, SR-like CTD-associated factor 8, SR-related and CTD-associated factor 8, SR-related CTD-associated factor 8
• Gene Symbols: SCAF8
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q9UPN6
• Gene ID (Entrez): 22828
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LSMTPETVKDVGFGSLVIPGGSVASNLATSALPAGNVFNAPTKQAEPEEKVPHLIDHQISSGENTRSVIPNDISSNAAILG
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only