Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCD-2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31012125UL
Description
SCD-2 Polyclonal specifically detects SCD-2 in Mouse samples. It is validated for Western Blot.Specifications
| SCD-2 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| SCD2 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of mouse SCD-2 (NP_033154.2). Peptide sequence SATTTITAPPSGGQQNGGEKFEKSSHHWGADVRPELKDDLYDPTYQDDEG | |
| 25 μg | |
| Primary | |
| Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 20250 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction