Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCD-2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$499.50
Specifications
| Antigen | SCD-2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB125143
|
Novus Biologicals
NBP310121100UL |
100 μg |
Each for $499.50
|
|
|||||
|
NB125144
|
Novus Biologicals
NBP31012125UL |
25 μg | Item Discontinued This item has been discontinued by the supplier. Please Sign In to view product availability in your area. | N/A | |||||
Description
SCD-2 Polyclonal specifically detects SCD-2 in Mouse samples. It is validated for Western Blot.Specifications
| SCD-2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| SCD2 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of mouse SCD-2 (NP_033154.2). Peptide sequence SATTTITAPPSGGQQNGGEKFEKSSHHWGADVRPELKDDLYDPTYQDDEG | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 20250 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title