Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCFD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SCFD2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SCFD2 Polyclonal specifically detects SCFD2 in Mouse samples. It is validated for Western Blot.Specifications
SCFD2 | |
Polyclonal | |
Rabbit | |
NP_848787 | |
152579 | |
Synthetic peptide directed towards the middle region of human Scfd2The immunogen for this antibody is Scfd2. Peptide sequence LVSGLSSLCEHLGVREECFAVGPLSRVIATDLANYAPAKNRKKTATGRAS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ21060, FLJ39514, sec1 family domain containing 2, STXBP1L1sec1 family domain-containing protein 2, syntaxin binding protein 1-like 1, Syntaxin-binding protein 1-like 1 | |
Scfd2 | |
IgG | |
52 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title