Learn More
Description
Specifications
Specifications
| Antigen | SDCCAG10 |
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | Antigen NY-CO-10, CWC27 spliceosome-associated protein homolog (S. cerevisiae), EC 5.2.1.8, NY-CO-10, peptidyl-prolyl cis-trans isomerase SDCCAG10, PPIase CWC27, PPIase SDCCAG10, SDCCAG10, Serologically defined colon cancer antigen 10peptidyl-prolyl cis-trans isomerase CWC27 homolog |
| Gene Symbols | CWC27 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPH |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
