SDCCAG10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25643825UL

Catalog No. NB394487

Description

SDCCAG10 Polyclonal specifically detects SDCCAG10 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SDCCAG10
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: Antigen NY-CO-10, CWC27 spliceosome-associated protein homolog (S. cerevisiae), EC 5.2.1.8, NY-CO-10, peptidyl-prolyl cis-trans isomerase SDCCAG10, PPIase CWC27, PPIase SDCCAG10, SDCCAG10, Serologically defined colon cancer antigen 10peptidyl-prolyl cis-trans isomerase CWC27 homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10283
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CWC27
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYNMLRLSEVDIDDDERPHNPH
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only