SDE2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156373

Catalog No. NBP156373

Description

SDE2 Polyclonal specifically detects SDE2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C1orf55
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C1orf55, chromosome 1 open reading frame 55, dJ671D7.1, FLJ35382, hypothetical protein LOC163859, RP4-671D7.1, SDE2 telomere maintenance homolog (S. pombe)
• Host Species: Rabbit
• Molecular Weight of Antigen: 50 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6IQ49
• Gene Symbols: SDE2
• Immunogen: Synthetic peptide directed towards the C terminal of human C1orf55 (NP_689821). Peptide sequence AFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQID.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 163859
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.