Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SDE2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$158.00 - $487.50

Specifications

Antigen	C1orf55
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15637320 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15637320UL	20 μL	Each for $158.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP156373 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP156373	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SDE2 Polyclonal specifically detects SDE2 in Human samples. It is validated for Western Blot.

Specifications

Antigen	C1orf55
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q6IQ49
Gene ID (Entrez)	163859
Immunogen	Synthetic peptide directed towards the C terminal of human C1orf55 (NP_689821). Peptide sequence AFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQID.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	C1orf55, chromosome 1 open reading frame 55, dJ671D7.1, FLJ35382, hypothetical protein LOC163859, RP4-671D7.1, SDE2 telomere maintenance homolog (S. pombe)
Gene Symbols	SDE2
Isotype	IgG
Molecular Weight of Antigen	50 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SDE2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents