Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SDE2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15637320UL
Description
SDE2 Polyclonal specifically detects SDE2 in Human samples. It is validated for Western Blot.Specifications
C1orf55 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q6IQ49 | |
SDE2 | |
Synthetic peptide directed towards the C terminal of human C1orf55 (NP_689821). Peptide sequence AFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQID. | |
Affinity Purified | |
RUO | |
163859 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C1orf55, chromosome 1 open reading frame 55, dJ671D7.1, FLJ35382, hypothetical protein LOC163859, RP4-671D7.1, SDE2 telomere maintenance homolog (S. pombe) | |
Rabbit | |
50 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction