Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SDR16C5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $646.00
Specifications
| Antigen | SDR16C5 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SDR16C5 Polyclonal specifically detects SDR16C5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SDR16C5 | |
| Polyclonal | |
| Rabbit | |
| metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 195814 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:CTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYLGILHAMDGFVDQKKKL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 1.1.1.105, EPHD-2, epidermal retinol dehydrogenase 2, FLJ33105, RDH-E2epidermal retinal dehydrogenase 2, RDHE2RDH#2, retinal short chain dehydrogenase reductase, Retinal short-chain dehydrogenase reductase 2, retSDR2, short chain dehydrogenase/reductase family 16C, member 5, Short-chain dehydrogenase/reductase family 16C member 5 | |
| SDR16C5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title