Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SDR39U1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB169943 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB169943 100 μg
NB169944 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB169943 Supplier Novus Biologicals Supplier No. NBP317434100UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SDR39U1 Polyclonal antibody specifically detects SDR39U1 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen SDR39U1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias C14orf124, chromosome 14 open reading frame 124, epimerase family protein SDR39U1, HCDIShort-chain dehydrogenase/reductase family 39U member 1, short chain dehydrogenase/reductase family 39U, member 1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: VNLAGENILNPLRRWNETFQKEVLGSRLETTQLLAKAITKAPQPPKAWVLVTGVAYYQPSLTAEYDEDSPGGDFDFFSNLVTKWEAAA
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 56948
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.